Key features and details | |
Cat. No. | MABL-3386 |
Name | Anti-Bet v 1 mAbs |
Clone No. | AFD-H3-1 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | ELISA |
Species Reactivity | Alnus glutinosa (European alder), Betula alnus var. glutinosa, Betula pendula (European white birch), Betula verrucosa, Corylus avellana (European hazel), Corylus maxima, Malus domestica (Apple), Pyrus malus |
Basic Information | |
Specificity | This antibody reacts with native Bet v 1 and homologous allergens. This antibody can also bind Bet v 1‐related allergens namely Aln g 1, Cor a 1, Mal d 1. This antibody specifically binds C‐terminal F2 domain of Bet v 1 (amino acids 130‐160) and the binding epitope comprises the amino acid sequence 'KAEQVKASKEMGETLLRAVESYLLAHSDAYN'. This antibody recognized not only folded Bet v 1 but also a synthetic, unfolded peptide derived from the C‐terminus of Bet v 1. |
Alternative Name | BETVIA; BETVI; Major pollen allergen Bet v 1-A; Allergen Bet v 1-A; ALNGI; Major pollen allergen Aln g 1; Allergen Aln g I; CORAI; Major pollen allergen Cor a 1; Allergen Cor a I; MALDI; MALD1; Major allergen Mal d 1 |
UniProt | P15494; P38948; Q08407; Q9SYW3 |
Immunogen | The original antibody was isolated from a phage‐displayed combinatorial single‐chain fragment (ScFv) library generated from the peripheral blood mononuclear cells of an immunized subject and screened for Bet v 1‐reactive antibody fragments. |
Application Notes | The reactivity of this antibody to Bet v 1 and related allergens Aln g 1, Cor a 1, Mal d 1 was determined using ELISA. This antibody reacted best with rBet v 1 but also with the cross‐reactive allergens from alder (Aln g 1), hazel (Cor a 1), and apple (Mal d 1). The original scFv version of this antibody binds Bet v 1, Aln g 1, Cor a 1, and Mal d 1 with a binding affinity of Bet v 1: KD= 6.22 × 10−10 M, Mal d 1: KD= 2.57 × 10−9 M, Aln g 1: KD= 2.96 × 10−9 M and Cor a 1: KD= 6.83 × 10−9 M respectively (PMID:29315611). This antibody inhibited allergic patients’ polyclonal IgE binding to Bet v 1, and partially suppressed allergen‐induced basophil activation (PMID: 29315611). |
Antibody First Published | Gadermaier et al. Isolation of a high‐affinity Bet v 1‐specific IgG‐derived ScFv from a subject vaccinated with hypoallergenic Bet v 1 fragments. Allergy. 2018 Jul; 73(7): 1425–1435. PMID:29315611 |
Note on publication | |
COA Information (For reference only, actual COA shall prevail) | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |