Key features and details | |
Cat. No. | MABL-141 |
Name | Anti-SVOP mAbs [N356/23](MABL-141) |
Clone No. | AFD-N356/23 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | ICC, WB |
Species Reactivity | Rat |
Basic Information | |
Specificity | This antibody is specific for SVOP epitope: amino acids 1-85. The antibody does not cross- react with SVOPL/SVOP2. SVOP has transmembrane transporter activity. |
Alternative Name | N356/23R; Synaptic vesicle 2-related protein; SV2-related protein |
UniProt | Q9Z2I7 |
Immunogen | This antibody was raised by immunising BALB/c mice with SVOP epitope: amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK,cytoplasmic N-terminus) of rat SVOP |
Application Notes | This antibody is recommended for detection and analysis of SVOP by western blot and immunocytochemistry. For instance, the mouse version of this antibody was used to detect SVOP by western blot in adult rat brain membranes and membranes from SVOP knockout and wild-type mice. |
Antibody First Published | Andrews et al. A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain eLife. 2019; 8: e43322. PMID:30667360 |
Note on publication | This article describes the generation of a library of recombinant monoclonal antibodies (R-mAbs) from a pool of mAb-producing hybridomas for neuroscience research. |
COA Information (For reference only, actual COA shall prevail) | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |

