| Key features and details | |
| Cat. No. | MABL-2546 | 
| Name | Anti-OPG mAbs | 
| Clone No. | AFD- AbAb01OPG | 
| From | Recombinant Antibody | 
| Isotype | Engineer antibody | 
| Application | ELISA | 
| Species Reactivity | Human | 
| Basic Information | |
| Specificity | This antibody is specific for the N-terminal epitope of OPG. | 
| Alternative Name | Osteoprotegerin; OCIF; PDB5; TR1; TNFRSF11B; Tumor necrosis factor receptor superfamily member 11b; TNF receptor superfamily member 11b; Osteoclastogenesis inhibitory factor | 
| UniProt | O00300 | 
| Immunogen | The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope(MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ). | 
| Application Notes | This antibody was generated as a capture antibody that binds to the N-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding detection antibody (AbAb02OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A). | 
| Antibody First Published | |
| Note on publication | |
| COA Information (For reference only, actual COA shall prevail) | |
| Size | 100 μg Purified antibody. | 
| Concentration | 1 mg/ml. | 
| Purification | Protein A affinity purified | 
| Buffer | PBS with 0.02% Proclin 300. | 
| Concentration | 1 mg/ml. | 
| Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. | 

 
  



