Key features and details | |
Cat. No. | MABL-2690 |
Name | Anti-Phospholipase A2 mAbs |
Clone No. | AFD- AbAb02-PLA2 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | ELISA |
Species Reactivity | Bungarus fasciatus (Banded krait), Naja naja atra (Chinese cobra), Ophiophagus hannah (King Cobra) |
Basic Information | |
Specificity | This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait). |
Alternative Name | PLA2; Snake venom phospholipase A2; Phospholipase A2 5 |
UniProt | |
Immunogen | A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGT |
Application Notes | This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA. |
Antibody First Published | |
Note on publication | |
COA Information (For reference only, actual COA shall prevail) | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |




