Key features and details | |
Cat. No. | MABL-426 |
Name | Anti-ApoA1 mAbs |
Clone No. | AFD- D11-6 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | ELISA |
Species Reactivity | Human |
Basic Information | |
Specificity | The antibody is specific for ApoA1. The antibody recognizes the epitope exposed by the ApoA1 protein on an HDL subclass significantly positively correlated with CHD, and the recognition epitope is determined on a polypeptide sequence comprising 41 amino acids (LGEEMRDRRAHVDALRTHLAPYSDELRQRLAARLEALKEN). The antibody does not react with HSA and the recombinant protein SAA1. Apolipoprotein A1 (ApoA1) is the main structural protein of high-density lipoprotein (HDL), and its physiological function is to help HDL capture free cholesterol. |
Alternative Name | Apo-AI; ApoA-I; Apolipoprotein A-I; Apolipoprotein A1 |
UniProt | P02647 |
Immunogen | The original antibody was generated by immunizing BALB/c mice with human ApoA1. |
Application Notes | The specificity of the antibody for ApoA1 protein was confirmed by ELISA analysis. The binding affinity of the antibody was 9.6×10^-10 M. The antibody was employed for detection of APOA1.The antibody could identify a possible pathogenic HDL subtype, and the detection result was positively correlated with CHD. Further, the detection results of the kit developed by the antibody had high consistency with the clinical diagnosis results (CN113265002A). |
Antibody First Published | |
Note on publication | |
COA Information （For reference only, actual COA shall prevail） | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |
