Name
BNP Protein
Cat. No.
MAG-1358
Tag/Conjugates
His
Source
Escherichia Coli.
Shipping
At Room Temperature
Description
B-type Natriuretic Peptide Recombinant Human produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3,500 Dalton. NPPB is purified by proprietary chromatographic techniques.
Synonyms
NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Introduction
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Biological Activity
/
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Natriuretic Peptide Precursor B was lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Solubility
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Amino acid sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Usage
Mabioway's Co., Ltd products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Background
B-Type Natriuretic Peptide Human Recombinant: Expanding the Horizons of Cardiovascular Medicine Abstract: B-Type Natriuretic Peptide (BNP) human recombinant is a significant biomarker and therapeutic agent in the field of cardiovascular medicine. This research paper aims to provide an in-depth analysis of BNP, including its physiological role, diagnostic utility, and therapeutic potential. Furthermore, innovative methodologies for the production and application of BNP human recombinant are proposed, emphasizing its promising prospects in cardiovascular disease management. Introduction: Cardiovascular diseases (CVDs) pose a global health burden, necessitating novel diagnostic and therapeutic strategies. BNP, a cardiac hormone, has emerged as a valuable tool in the assessment and management of CVDs. This paper delves into the distinctive characteristics of BNP and explores its diagnostic and therapeutic implications, shedding light on its potential as a game-changer in cardiovascular medicine. Physiological Role and Mechanisms: BNP is primarily secreted by the ventricular myocardium in response to increased cardiac wall stress. It exerts its effects through binding to the natriuretic peptide receptor, stimulating cyclic guanosine monophosphate (cGMP) production and promoting vasodilation, natriuresis, and diuresis. Additionally, BNP counteracts the renin-angiotensin-aldosterone system, antagonizing the deleterious effects of cardiac remodeling and fibrosis. Diagnostic Utility: BNP levels serve as a reliable biomarker for the diagnosis, risk stratification, and monitoring of various cardiovascular conditions, including heart failure, myocardial infarction, and pulmonary hypertension. Measurements of BNP and its inactive fragment, N-terminal pro-BNP (NT-proBNP), aid in the accurate assessment of cardiac function, guiding therapeutic decisions and predicting clinical outcomes. Production and Application of BNP Human Recombinant: Efficient production methodologies and innovative applications of BNP human recombinant play a pivotal role in advancing cardiovascular medicine. Recombinant protein expression systems, such as bacterial expression systems and mammalian cell culture, have been employed to produce functional BNP. Novel strategies, including targeted delivery systems and BNP-based therapies, hold promise for enhancing the therapeutic efficacy and reducing the adverse effects associated with traditional treatment approaches. Therapeutic Potential: BNP human recombinant demonstrates significant therapeutic potential in the management of cardiovascular diseases. Synthetic BNP analogs, including neprilysin inhibitors, offer novel approaches to enhance endogenous BNP signaling and improve cardiac function. Furthermore, BNP-based therapies, such as gene therapy and BNP receptor agonists, hold promise in promoting myocardial regeneration, attenuating cardiac remodeling, and improving clinical outcomes in heart failure patients. Conclusion: BNP human recombinant emerges as a promising avenue in cardiovascular medicine, contributing to the diagnosis, risk stratification, and therapeutic interventions for various cardiovascular conditions. Optimization of production methodologies and exploration of novel therapeutic strategies will further enhance the clinical applications of BNP. Leveraging the potential of BNP as a diagnostic biomarker and therapeutic agent may revolutionize the management of cardiovascular diseases, improving patient outcomes and quality of life.
