Key features and details | |
Cat. No. | MABL-3439 |
Name | Anti-Strep-Tag II mAbs [C23.21](MABL-3439) |
Clone No. | C23.21 |
From | Recombinant Antibody |
Isotype | Engineer antibody |
Application | WB, ELISA |
Species Reactivity | Streptomyces avidinii |
Basic Information | |
Specificity | This antibody recognizes an antigen with amino acid sequence 'WSHPQFEK' present in the Strep Tag with a dissociation constant of 1.4x10^-10M. It recognizes another fusion protein namely VHH-E9 containing the strep-tag sequence of 'LESAWSHPQFEK' at the C terminus with a dissociation constant of 9.1x10^-10M. |
Alternative Name | Streptavidin; 'WSHPQFEK'; strep-tag |
UniProt | P22629 |
Immunogen | The original antibody was generated by immunizing BALB/c mice with recombinant ectodomain of glycoprotein E2 of GB virus, containing a double Strep-Tag of amino acid sequence 'AGWSHPQFEKGGGSGGGSGGGSWSHPQFEK'. |
Application Notes | This high affinity antibody can detect the strep-tag II fusion proteins in ELISA and western blot assay. This antibody is recommended for strep-tag recognition in fusion proteins through western blotting or immunohistochemistry methods, or to immobilize strep-tagged fusion proteins on Biacore sensor chips for performing Surface Plasmon Resonance (SPR)-mediated protein interaction studies. It can also be used for the purification of strep-tagged recombinant proteins using an affinity column or immunoprecipitation meothod. |
Antibody First Published | |
Note on publication | |
COA Information (For reference only, actual COA shall prevail) | |
Size | 100 μg Purified antibody. |
Concentration | 1 mg/ml. |
Purification | Protein A affinity purified |
Buffer | PBS with 0.02% Proclin 300. |
Concentration | 1 mg/ml. |
Storage Recommendation | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C. |

