Cat. No.
MABL-3386
Application
ELISA;
Isotype
Engineer antibody
Species Reactivity
Alnus glutinosa (European alder), Betula alnus var. glutinosa, Betula pendula (European white birch), Betula verrucosa, Corylus avellana (European hazel), Corylus maxima, Malus domestica (Apple), Pyrus malus
Clone No.
AFD-H3-1
From
Recombinant Antibody
Specificity
This antibody reacts with native Bet v 1 and homologous allergens. This antibody can also bind Bet v 1‐related allergens namely Aln g 1, Cor a 1, Mal d 1. This antibody specifically binds C‐terminal F2 domain of Bet v 1 (amino acids 130‐160) and the binding epitope comprises the amino acid sequence 'KAEQVKASKEMGETLLRAVESYLLAHSDAYN'. This antibody recognized not only folded Bet v 1 but also a synthetic, unfolded peptide derived from the C‐terminus of Bet v 1.
Alternative Names
BETVIA; BETVI; Major pollen allergen Bet v 1-A; Allergen Bet v 1-A; ALNGI; Major pollen allergen Aln g 1; Allergen Aln g I; CORAI; Major pollen allergen Cor a 1; Allergen Cor a I; MALDI; MALD1; Major allergen Mal d 1
UniProt
P15494; P38948; Q08407; Q9SYW3
Immunogen
The original antibody was isolated from a phage‐displayed combinatorial single‐chain fragment (ScFv) library generated from the peripheral blood mononuclear cells of an immunized subject and screened for Bet v 1‐reactive antibody fragments.
Application Notes
The reactivity of this antibody to Bet v 1 and related allergens Aln g 1, Cor a 1, Mal d 1 was determined using ELISA. This antibody reacted best with rBet v 1 but also with the cross‐reactive allergens from alder (Aln g 1), hazel (Cor a 1), and apple (Mal d 1). The original scFv version of this antibody binds Bet v 1, Aln g 1, Cor a 1, and Mal d 1 with a binding affinity of Bet v 1: KD= 6.22 × 10−10 M, Mal d 1: KD= 2.57 × 10−9 M, Aln g 1: KD= 2.96 × 10−9 M and Cor a 1: KD= 6.83 × 10−9 M respectively (PMID:29315611). This antibody inhibited allergic patients’ polyclonal IgE binding to Bet v 1, and partially suppressed allergen‐induced basophil activation (PMID: 29315611).
Antibody First Published
Gadermaier et al. Isolation of a high‐affinity Bet v 1‐specific IgG‐derived ScFv from a subject vaccinated with hypoallergenic Bet v 1 fragments. Allergy. 2018 Jul; 73(7): 1425–1435.
PMID:29315611
Note on publication
Size
100 μg Purified antibody.
Concentration
1 mg/ml.
Purification
Protein A affinity purified
Buffer
PBS with 0.02% Proclin 300.
Storage Recommendation
Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C.

