Cat. No.
MABL-131
Application
ICC, WB, IHC
Isotype
Engineer antibody
Species Reactivity
Rat
Clone No.
N323B/20
From
Recombinant Antibody
Specificity
This antibody is specific for the SUR2B protein and does not cross react with SUR1. SUR2B is a subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.
Alternative Names
N323B/20R; ATP-binding cassette sub-family C member 9; Abcc9; Sulfonylurea receptor 2
UniProt
Q63563
Immunogen
This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503- 1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.
Application Notes
This antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot.
Antibody First Published
Andrews et al. A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain eLife. 2019; 8: e43322. PMID:30667360
Note on publication
This article describes the generation of a library of recombinant monoclonal antibodies (R-mAbs) from a pool of mAb-producing hybridomas for neuroscience research.
Size
100 μg Purified antibody.
Concentration
1 mg/ml.
Purification
Protein A affinity purified
Buffer
PBS with 0.02% Proclin 300.
Storage Recommendation
Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C.

