Cat. No.
MABL-141
Application
ICC, WB
Isotype
Engineer antibody
Species Reactivity
Rat
Clone No.
N356/23
From
Recombinant Antibody
Specificity
This antibody is specific for SVOP epitope: amino acids 1-85. The antibody does not cross- react with SVOPL/SVOP2. SVOP has transmembrane transporter activity.
Alternative Names
N356/23R; Synaptic vesicle 2-related protein; SV2-related protein
UniProt
Q9Z2I7
Immunogen
This antibody was raised by immunising BALB/c mice with SVOP epitope: amino acids 1-85
(MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK,cytoplasmic N-terminus) of rat SVOP
Application Notes
This antibody is recommended for detection and analysis of SVOP by western blot and immunocytochemistry. For instance, the mouse version of this antibody was used to detect SVOP by western blot in adult rat brain membranes and membranes from SVOP knockout and wild-type mice.
Antibody First Published
Andrews et al. A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain eLife. 2019; 8: e43322. PMID:30667360
Note on publication
This article describes the generation of a library of recombinant monoclonal antibodies (R-mAbs) from a pool of mAb-producing hybridomas for neuroscience research.
Size
100 μg Purified antibody.
Concentration
1 mg/ml.
Purification
Protein A affinity purified
Buffer
PBS with 0.02% Proclin 300.
Storage Recommendation
Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at - 20⁰C.

